SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017221 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017221
Domain Number 1 Region: 1-176,224-326
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.32e-114
Family Calpain large subunit, catalytic domain (domain II) 0.000000000492
Further Details:      
 
Domain Number 2 Region: 330-486
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.12e-56
Family Calpain large subunit, middle domain (domain III) 0.0000000932
Further Details:      
 
Domain Number 3 Region: 553-716
Classification Level Classification E-value
Superfamily EF-hand 2.28e-44
Family Penta-EF-hand proteins 0.000000819
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017221   Gene: ENSMGAG00000008632   Transcript: ENSMGAT00000020905
Sequence length 728
Comment pep:novel chromosome:UMD2:2:17550369:17569886:-1 gene:ENSMGAG00000008632 transcript:ENSMGAT00000020905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWCRPTELCSCPRFIAGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPRDQSFQD
EYAGIFHFQFWQYGEWVDVVVDDRLPTKNGELLFVHSAEGSEFWSALLEKAYAKLNGSYE
ALSGGTTTEGFEDFTGGIAEWYELQKAPPNLFKIIQKALQKGSLLGCSIDNDTNLMLGVG
ESKHIPLLVSALYTVNLSEKKGNRRLVKCCNSSLLLQITSAAETEAVTSQKLVKGHAYSV
TGAEEVNFRGSIQKLIRIRNPWGEVEWTGKWNDNCPNWSGVDPEVRERLTRRHEDGEFWM
AFNDFLRHYSRLEICNLTPDTLSSDRYKKWSLLKLDGNWRRGATAGGCRNYPNTFWTNPQ
YLIKLEEEDEDPDDPEGGCTFLIGLIQKHRRKQRKMGEDMHTIGFAIYEVPPEFSGQTNI
HLSKNFFLTNKAREKSNTFINLREVLNRFKLPAGEYIIVPSTFEPNLNGDFCLRVFSEKN
ANSAVIDDEIEANFEEVLARTYPTLVGNLGSPGAQDQVLPAEITEDIGNSLCCPEIQEHK
PLAIEFDKTEISEDDIEPSFKKLFGQLAGSDAEISAFELRSILNKILAKRQDIKSDGFSI
ETCKIMVDLLDNDGSGKLGLKEFHTLWTKIQKYQKIYREIDVDRSGTMNSYEMRRALEAA
GFKLNGQLHQIIVARFADEDLIIDFDNFVRCLIRLETLFKMFRKLDTEKTGTIELNLINL
WLDIYSHM
Download sequence
Identical sequences G3UNU1
ENSMGAP00000017221 ENSMGAP00000017221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]