SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017264 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017264
Domain Number 1 Region: 15-205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-27
Family G proteins 0.0024
Further Details:      
 
Domain Number 2 Region: 419-589
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.51e-26
Family G proteins 0.01
Further Details:      
 
Domain Number 3 Region: 171-271,313-371
Classification Level Classification E-value
Superfamily EF-hand 1.51e-22
Family Parvalbumin 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017264   Gene: ENSMGAG00000007956   Transcript: ENSMGAT00000019729
Sequence length 663
Comment pep:novel chromosome:UMD2:20:8403303:8425768:-1 gene:ENSMGAG00000007956 transcript:ENSMGAT00000019729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRDGVLVEITGEEARVGKTSLIMSLVSEEFPEEPKVPPRAEEITIPADVTPERVPTHIVD
YSEAEQNDEQLYHEISQANVICIVYAVNNKNSIDKVTSRWIPLINERTDKDSRLPLILVG
NKSDLVEYSSMETILPIMNQYTEIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPE
EKEMKPACIKALTRIFRISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKNV
SDGVADNGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLELTPEYLFPLLKIPPDC
TTELNHHAYLFLQSIFDKHDLDRDCALSTDELKDLFKVFPYMPWGPDVNNTVCTNERGWI
TYQGFLSQWTLTTYLDVQRCLEYLGYLGYSILAEQESQASAITEVTRDKKIDLQKKQTQR
NVFRCNVVGMKGCGKSGVLQALLGRNLMRQRQIRAEHKSYYAINTVYVYGQEKYLLLHDV
SDSDFLTDAETICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLVVAAKSDLHEVRQ
EYSISPAEFCKKHKMPPPQAFTCNTVDMPSKDIFVKLTTMAMYPHARLRCMCACNRCTFC
ICQNFLNSDLLQSVKNKLFTAVLNRHVTQADLKSSTFWLRASFGATVFAFLGFAMYKALI
KQR
Download sequence
Identical sequences G3UNY2
ENSMGAP00000017264 ENSMGAP00000017264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]