SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017273 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017273
Domain Number 1 Region: 152-244
Classification Level Classification E-value
Superfamily EF-hand 1.36e-22
Family Osteonectin 0.00000323
Further Details:      
 
Domain Number 2 Region: 94-149
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000166
Family Ovomucoid domain III-like 0.0000765
Further Details:      
 
Domain Number 3 Region: 69-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000215
Family Follistatin (FS) module N-terminal domain, FS-N 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017273   Gene: ENSMGAG00000006021   Transcript: ENSMGAT00000020013
Sequence length 244
Comment pep:known chromosome:UMD2:15:12473313:12635495:1 gene:ENSMGAG00000006021 transcript:ENSMGAT00000020013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWIFFLLCLAGKALAAPQQEALPDETEVIEDLTTEVVEEPVGANPVQVEVGEFEEPTE
DVEEIVAENPCQNHHCKHGKVCEVDDNNSPMCVCQDPSSCPATSGVFEKVCGTDNKTYDS
SCHFFATKCTLEGTKKGHKLHLDYIGPCKFIPACLDTELTEFPLRMRDWLKNVLITLYER
DEDNNLLTEKQKLKVKKIHENEKRLEAGDHTVELLARDFEKNYNMYIFPVHWQFGQLDQH
PIDG
Download sequence
Identical sequences G3UNZ0
ENSMGAP00000017273 ENSMGAP00000017273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]