SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017351 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017351
Domain Number 1 Region: 39-267,315-418
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.64e-130
Family Calpain large subunit, catalytic domain (domain II) 0.00000000706
Further Details:      
 
Domain Number 2 Region: 422-572
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 9.03e-56
Family Calpain large subunit, middle domain (domain III) 0.0000016
Further Details:      
 
Domain Number 3 Region: 637-809
Classification Level Classification E-value
Superfamily EF-hand 1.37e-52
Family Penta-EF-hand proteins 0.00000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017351   Gene: ENSMGAG00000011468   Transcript: ENSMGAT00000019003
Sequence length 810
Comment pep:novel chromosome:UMD2:5:26427715:26451736:1 gene:ENSMGAG00000011468 transcript:ENSMGAT00000019003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSAINPAVAQQTAAGSVSSTTSTTTEGTGGGTGGIYSAIISRNQPIIKVKEKTYEELHK
KCLEKNILYEDPDFPPNETSLFYSQKVPIKFEWKRPREICENPRFIIGGANRTDICQGEL
GDCWFLAAIACLTLNKKLLCRVIPHDQSFIQNYAGIFHFQFWRYGDWVDVIIDDCLPTYN
NQLVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEIKDAPK
DIYKIMKHAIARGSLMASSIDDNLGFSYGAAPRSDIGEMIARMVKNLENAQMTHPTVDHQ
GTDERPAWTIMPMQYETRMSCGLVKGHAYSVTAVEETTFKGEKIRLIRLRNPWGQVEWNG
PWSDKSEEWNFIKEEEKIRLQHKILEDGEFWISFEDFMRHFTKLEICNLTPDTLEADKLQ
TWTVSVNEGRWVRGCSAGGCRNYPDTFWTNPQYRLKLLEEDDDPEDEEVICSFLVALMQK
NRRKERKLGANLYTIGFAIYEVPVQMHGTKHHLQKDFFLYNASKARSKTYINMREISERF
RLPPSEYVIIPSTYEPHQEGEFILRVFSEKRSLSEEVENMIEADRPSKKKKGKPIIFVSD
RANSNKELTTDEDAGKDGEKTHVDEKKRSSAKAREKSEEETQFRNIFRQIAGDDMEINAE
ELRNVLNNVVKKHKDLKTEGFELESCRSMIALMDTDGSGKINFDEFRHLWDKIKSWQKIF
KHYDADHSGTINSYEMRNAVKDAGFRLNNQLYDIITMRYADKNMNIDFDSFICCFVRLDA
MFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
Download sequence
Identical sequences G3UP61
ENSMGAP00000017351 ENSMGAP00000017351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]