SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018253 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018253
Domain Number 1 Region: 57-196
Classification Level Classification E-value
Superfamily EF-hand 5.73e-42
Family Calmodulin-like 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018253   Gene: ENSMGAG00000000945   Transcript: ENSMGAT00000018283
Sequence length 203
Comment pep:known chromosome:UMD2:22:468999:475019:-1 gene:ENSMGAG00000000945 transcript:ENSMGAT00000018283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGTCAATQGSCVPLLSSNSPALPTGTTTAANMSSKRAKAKTTKKRPQRATSNVFAMFDQS
QIQEFKEAFNMIDQNRDGFIDKEDLHDMLASMGKNPTDEYLEGMMSEAPGPINFTMFLTM
FGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPID
KKGNFNYVEFTRILKHGAKDKDD
Download sequence
Identical sequences G1MQI0
ENSMGAP00000018253 ENSMGAP00000000336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]