SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018907 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018907
Domain Number 1 Region: 20-185
Classification Level Classification E-value
Superfamily EF-hand 3.18e-42
Family Penta-EF-hand proteins 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018907   Gene: ENSMGAG00000017021   Transcript: ENSMGAT00000020205
Sequence length 188
Comment pep:novel chromosome:UMD2:25:5012005:5014074:1 gene:ENSMGAG00000017021 transcript:ENSMGAT00000020205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVPEAEPWRGFRGGAPQGVDPEAFSWFQAVDADRSGYISVKELKQALLNSNWSAFNDET
CLLMINMFDRSRSGRMDVYGFSALLRFIQQWKNLFQQYDRDQSGSISFSELQQAFSQMGY
NLSPQFSQLLLSRYAQRSSNPSIQLDRFIHICMQLQSLTEAFREKDTGMVGNVRLGYEDF
LTMVMTRM
Download sequence
Identical sequences G3UT72
ENSMGAP00000018907 ENSMGAP00000018907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]