SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019273 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019273
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily EF-hand 2.66e-34
Family p25-alpha 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019273   Gene: ENSMGAG00000017254   Transcript: ENSMGAT00000019084
Sequence length 101
Comment pep:novel scaffold:UMD2:GL425519.1:152:2427:-1 gene:ENSMGAG00000017254 transcript:ENSMGAT00000019084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPWTPIQELEESFRKFAIYGDTKATGQEMNGKNWAKLCKDCKVIDGKSVTGTDVDIVFS
KVKGKTARVINYEEFKKALEELASKRFKDKGKEEAYEAICQ
Download sequence
Identical sequences H9H2H9
ENSMGAP00000019273 ENSMGAP00000019273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]