SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002213 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002213
Domain Number 1 Region: 122-624
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.37e-163
Family Calponin-homology domain, CH-domain 0.00000000252
Further Details:      
 
Domain Number 2 Region: 4-143
Classification Level Classification E-value
Superfamily EF-hand 5.36e-17
Family Calmodulin-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002213   Gene: ENSMGAG00000002595   Transcript: ENSMGAT00000002888
Sequence length 631
Comment pep:known chromosome:UMD2:9:2416519:2458619:1 gene:ENSMGAG00000002595 transcript:ENSMGAT00000002888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHEMAVTMQISKDELEELKEAFAKVDLNSNGFICDYELHELFKEANLPLPGYKVREIIQK
LMIDSDKNKDGKISFEEFVYIFQEVKSSDIAKTFRKAINRKEGICAIGGTSELSSEGTQH
SYSEEEKYAFVNWINKALENDADCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTID
ERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLREGKPHLVLGLLWQIIKIGL
FADIELSRNEALAALLRDGENLEDLMKLSPEELLLRWANFHLENAGWHKINNFSTDIKDS
RAYFHLLNQIAPKGQKEGEPQIDINMSGFNEKDDLRRAEYMLQQADRLGCRQFVTPADVV
SGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHL
YGDLQDALVILQLYEKIKVPVDWNKVNKPPYPKLGANMKKLENCNYAVDLGKHPAKFSLV
GIGGQDLNDGNPTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNQTLKEAGKST
SIQNFKDKTISTSLAVVDLIDAIQPGCINYDLVKTGHLSEDDKQNNAKYAVSMARRIGAR
VYALPEDLVEVKPKMVMTVFACLMGRGMKRV
Download sequence
Identical sequences G1MUJ6
ENSMGAP00000002213 ENSMGAP00000002213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]