SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005212 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005212
Domain Number 1 Region: 201-492
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 9.03e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 4-174
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 7.06e-42
Family Cryptochrome/photolyase, N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005212   Gene: ENSMGAG00000005281   Transcript: ENSMGAT00000005944
Sequence length 534
Comment pep:novel chromosome:UMD2:28:1138347:1145007:-1 gene:ENSMGAG00000005281 transcript:ENSMGAT00000005944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHRTIHLFRKGLRLHDNPALLAALQSSEVVYPVYILDRAFMTSSMHIGALRWHFLLQSL
EDLRSSLCQLGSCLLVIQGEYDAVVRDHVQKWNITQVTLDAEMEPFYKEMEANIRALGEE
LGFEVLSLMGHSLYNTQRILELNGGTPPLTYKRFLHILSLLGDPEMPIRNLTAEDFQRCS
PPELCLAECYRVPLPTDLKIPPESISPWRGGESEGLQRLEQHLADRFQGWVASFTKPKTV
PNSLLPSTTGTTGLSPYFSMGCLSVRSFFYRLSNIYAQAKHHSLPPVSLQGQLLWREFFY
TVASATPNFTKMAGNPICLQIRWYEDAERLHRWKTAQTGFPWIDAIMTQLRQEGWIHHLA
RHAAACFLTRGDLWISWEEGMKVFEELLLDADYSINAGNWMWLSASAFFHHYTRIFCPVR
FGRRTDPEGQYIRKYLPILKNFPSKYIYEPWTASEEEQKQAGCIIGRDYPFPMVDHKEAS
DHNLQLMKQVREEQYRTAQLTRDDADDPMEMKLKRDHSEENLTKTKAARMTKQT
Download sequence
Identical sequences G1N163
ENSMGAP00000005212 ENSMGAP00000005212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]