SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011577 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011577
Domain Number 1 Region: 145-437
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 3.79e-96
Family Cryptochrome/photolyase FAD-binding domain 0.0000127
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.57e-31
Family Cryptochrome/photolyase, N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011577   Gene: ENSMGAG00000011088   Transcript: ENSMGAT00000012455
Sequence length 521
Comment pep:known chromosome:UMD2:5:24654488:24670583:-1 gene:ENSMGAG00000011088 transcript:ENSMGAT00000012455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFLLQSLEDLDNSLRKLNSRLFVVRGQPTDVFPRLFKEWGVTRLTFEYDSEPFGKERDAA
IIKLAKEAGVEVVVENSHTLYDLDRIIELNGNKPPLTYKRFQAIISRMELPKKPVSSIVS
QQMETCKVDIQENHDDMYGVPSLEELGFPTDGLAPAVWQGGETEALARLDKHLERKAWVA
NYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWELYKKVKRNSTPPLSLYGQLLW
REFFYTAATNNPKFDRMEGNPICIQIPWDKNPEALAKWAEGKTGFPWIDAIMTQLRQEGW
IHHLARHAVACFLTRGDLWISWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHC
YCPVGFGRRTDPSGDYVKRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPKPMVN
HAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSGPVTDSAPGQGSSSSTAIRLP
QSDQASPKRKLEGAEELCTEELYKRAKVTGLPSPEIPGKSS
Download sequence
Identical sequences G1NF23
ENSMGAP00000011577 ENSMGAP00000011577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]