SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013551 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013551
Domain Number 1 Region: 144-437
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 8.24e-99
Family Cryptochrome/photolyase FAD-binding domain 0.0000142
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 3.01e-31
Family Cryptochrome/photolyase, N-terminal domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013551   Gene: ENSMGAG00000012848   Transcript: ENSMGAT00000014462
Sequence length 572
Comment pep:known chromosome:UMD2:1:54600770:54615230:-1 gene:ENSMGAG00000012848 transcript:ENSMGAT00000014462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWSIAKLSIEYDSEPFGKERDAA
IKKLASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISRMEPLEMPVETITP
EVMQKCTTPVSDDHDEKYGVPSLEELGFDTDGLPSAVWPGGETEALTRLERHLERKAWVA
NFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLW
REFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGW
IHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFHC
YCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESVQKAAKCVIGVNYPKPMVN
HAEASRLNIERMKQIYQQLSRYRGLGLLATVPSNPNGNGNGGLMSFSPGESISGCSSAGA
SLGAQLGTGDGQTVGVQSCALGDSHTGGNGVQQQGYCQASSILRYAHGDNQQPHLMQPGR
ASLGTGISAGKRPNPEEETQSVGPKVQRQSTN
Download sequence
Identical sequences G1NJM2
ENSMGAP00000013551 ENSMGAP00000013551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]