SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019761 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019761
Domain Number 1 Region: 627-1049
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.84e-114
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000106
Further Details:      
 
Domain Number 2 Region: 24-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.29e-82
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000219
Further Details:      
 
Domain Number 3 Region: 290-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.31e-82
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000166
Further Details:      
 
Domain Number 4 Region: 1372-1542
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.89e-58
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000904
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019761   Gene: ENSMGAG00000009088   Transcript: ENSMGAT00000020617
Sequence length 1845
Comment pep:novel chromosome:UMD2:10:17289735:17293707:1 gene:ENSMGAG00000009088 transcript:ENSMGAT00000020617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGIILALVLTLVGSQKFDIDPGFRSRNSYLYNYEGFMLNGLQERSLGKAGVRLSSKLEI
SGLSENAYFLKIRSSQVEEYNGVWPRDSFTRSSKITQAISSCFTRPFKFEYSSGRIGNIY
APEDCPDLCVNIVRGILNMLQITIKKSQNVYELQEAGIGGVCHTRYVIQEDRKNSRVSVT
KTVDANNCQEKVQKSIGMAYIYPCPVDMMKERLTKGTAAFSYKLKQSDSSTLITEVVSQQ
VYQISPFSEPTGVAVMEARQQLTLLEVRSERGNAPDIPMQSYGSLRYHFPAVLPQMPLQL
IKTKNPEQRIVETLQHIILNNQQDFHDDVAYRFLELVQLCRIASVDTLESVWRQVSDKPR
YRRWLLSAVSVSGTTEALKFLKTRIRSDDLNYIQTLLTVSLTLHLMKADEHTLPIAADLM
TSSRIQKNPMLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA
LKCIGNMGEPASLKRILKFLPTSSSSASDIPIHIQIDAIMALRKIAWKDPKTVQGYLIQI
LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESNLQVASFVYSHMKSLSESRLP
FMYNISSACNIALKLLAPKLDRLSYWRSKVIRAGSYFDNYRVGAAGEIFVMNSPGTMFPS
AIISKLMANSAGSVADLIEVGIRAEGLTDVIMKRNIPFAEYPTYKKIKELGKALLGWKEL
PTETPLISAYLKILGQEVAFVNINKEVLQQAMKTVVEPADRNTAMKRIISQIRNGIAGQW
TQPVWMGELRYMVPSCLGLPLEYGSYTTALARAAVSVDGKMTPPLTGDFRLSQLLESTMQ
IRSDLNPSLYVHTVATMGINTEYFQHVVEIQGEVQTRMPMKFDAKIDMKLKNIKIETNPC
REETEIVVGRHKAFAVSRNIGELGAEKRTSILPGDAPLKIMEEPFQTSERASREHFTMQE
PDSMPRKQSHDSQEDLRHSTGKRTHKRDICLKMHRLGCQLCFSRRSRDASFIKNTYLHRL
IGEHEAKIVLMPVPTDADIDKIQLEIQAGSRAASKIINEVNSESEEEDESSPYEDIQAKL
KRILGIENVFKVANKTQHPKNRPSKKGNAMLAELGTEPNAKTSSSSSSVSSTATSSSSSS
ASSPNRKKPMDEEENDQVKQVRNKDSSSSSSSSSSSTSSSSSSSKSSSSSKDSSSRSSSS
SSKTRSRHSHQSRRLNGSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSSMHSKIWVTNIC
HKTTNFNIYSANTAAVSVSYSSAVAVRASQKFLQKHVSPIISFLPRLFISFLLFSKGHHE
IYQYRFRSAHRQEFPKRKLPVDRGTSRYSSTRSSRDTSRAASWPKFLGDIKTPVLAAFLH
GVSNNKKTGGLQLVVYTDTDSVRPRMQVFVTNLTDSSKWKLCADASVLNAHKAVAYLKWG
RNCRDYRVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSMVEWFYKFVPGAAFMLGFSERM
GKNPSRQARMVVALTSPRTCDIVVKLPDMTLYQEAMRLPLSLPVGPRIPASELQPPIWNV
FAEAPSAVLENLKARCSVSHNKITTFNEVKFNYSMPANCYHVLAQDCSSDLKFLVMMKSA
EEAANLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLVSAGASLWIHNENQGLV
LVAPAFGIDKLYFDGQTFSIQVALWMAGKTCGICGKYDAECEQEYRMPNGFLAKDAVSFG
HSWILEEAPCKGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCMKGCSATKTTPVTVG
FHCLPADSATSLADKQMKFDQKSEDMQDTVDAHTACSCENEECST
Download sequence
Identical sequences G5E7Q4
ENSMGAP00000019761 ENSMGAP00000019091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]