SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478428901|ref|YP_007541341.1| from Chlamydia trachomatis IU888

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478428901|ref|YP_007541341.1|
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.82e-23
Family Anti-sigma factor antagonist SpoIIaa 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478428901|ref|YP_007541341.1|
Sequence length 110
Comment anti-sigma F factor antagonist [Chlamydia trachomatis IU888]
Sequence
MEWIAREYKNIFIVSLKGDMDAVTVPALEEFLTKSIAKGRVNVLLNMEKVFYMSSAGLRT
LLSLAKLTQNHNGKLCICCLRDEVADIIRIAGLDKVITIRKAEQESFSDF
Download sequence
Identical sequences A0A0E9CNE8 A0A0H2X379 A0A0H3MCJ3 G4NPI4 O84770
gi|478475550|ref|YP_007725219.1| gi|527320490|ref|YP_008346690.1| gi|527322380|ref|YP_008348578.1| gi|385270496|ref|YP_005813656.1| gi|527329095|ref|YP_008355285.1| gi|478474645|ref|YP_007730721.1| gi|385270496|ref|YP_005813656.1| gi|15605498|ref|NP_220284.1| gi|527323337|ref|YP_008349534.1| gi|478471042|ref|YP_007729683.1| gi|478462031|ref|YP_007736981.1| gi|482545229|ref|YP_007851147.1| gi|527319571|ref|YP_008345772.1| gi|527325396|ref|YP_008351590.1| gi|478428901|ref|YP_007541341.1| gi|527324263|ref|YP_008350459.1| gi|478473741|ref|YP_007735189.1| gi|527321444|ref|YP_008347643.1| gi|166154107|ref|YP_001654225.1| gi|568112039|ref|YP_008921649.1| gi|478467433|ref|YP_007718965.1| gi|237805116|ref|YP_002889270.1| gi|76789507|ref|YP_328593.1| NP_220284.1.57406 WP_009872145.1.100466 WP_009872145.1.100644 WP_009872145.1.100883 WP_009872145.1.101362 WP_009872145.1.101735 WP_009872145.1.102133 WP_009872145.1.11148 WP_009872145.1.11717 WP_009872145.1.11732 WP_009872145.1.13674 WP_009872145.1.13766 WP_009872145.1.13837 WP_009872145.1.1409 WP_009872145.1.14786 WP_009872145.1.14984 WP_009872145.1.15381 WP_009872145.1.17082 WP_009872145.1.17422 WP_009872145.1.18643 WP_009872145.1.1923 WP_009872145.1.19304 WP_009872145.1.20022 WP_009872145.1.20093 WP_009872145.1.22210 WP_009872145.1.25195 WP_009872145.1.25246 WP_009872145.1.27753 WP_009872145.1.27980 WP_009872145.1.28239 WP_009872145.1.29171 WP_009872145.1.30792 WP_009872145.1.31128 WP_009872145.1.31373 WP_009872145.1.32156 WP_009872145.1.32801 WP_009872145.1.32856 WP_009872145.1.35043 WP_009872145.1.36244 WP_009872145.1.36518 WP_009872145.1.3661 WP_009872145.1.37417 WP_009872145.1.37673 WP_009872145.1.37956 WP_009872145.1.38181 WP_009872145.1.38504 WP_009872145.1.38794 WP_009872145.1.38813 WP_009872145.1.39258 WP_009872145.1.40272 WP_009872145.1.40464 WP_009872145.1.40808 WP_009872145.1.4187 WP_009872145.1.4264 WP_009872145.1.42718 WP_009872145.1.42889 WP_009872145.1.43504 WP_009872145.1.44223 WP_009872145.1.45552 WP_009872145.1.48551 WP_009872145.1.48923 WP_009872145.1.4939 WP_009872145.1.49465 WP_009872145.1.5036 WP_009872145.1.51159 WP_009872145.1.51530 WP_009872145.1.52091 WP_009872145.1.53299 WP_009872145.1.5416 WP_009872145.1.57520 WP_009872145.1.57533 WP_009872145.1.58046 WP_009872145.1.58308 WP_009872145.1.5967 WP_009872145.1.60427 WP_009872145.1.61004 WP_009872145.1.6151 WP_009872145.1.61683 WP_009872145.1.62239 WP_009872145.1.62489 WP_009872145.1.62510 WP_009872145.1.62968 WP_009872145.1.64162 WP_009872145.1.65182 WP_009872145.1.65391 WP_009872145.1.66489 WP_009872145.1.67104 WP_009872145.1.67250 WP_009872145.1.69355 WP_009872145.1.69519 WP_009872145.1.69991 WP_009872145.1.71307 WP_009872145.1.71686 WP_009872145.1.72034 WP_009872145.1.72164 WP_009872145.1.72442 WP_009872145.1.74635 WP_009872145.1.75470 WP_009872145.1.77153 WP_009872145.1.78375 WP_009872145.1.79775 WP_009872145.1.83525 WP_009872145.1.83642 WP_009872145.1.85256 WP_009872145.1.85365 WP_009872145.1.87079 WP_009872145.1.87298 WP_009872145.1.87666 WP_009872145.1.88177 WP_009872145.1.88937 WP_009872145.1.9107 WP_009872145.1.92427 WP_009872145.1.93216 WP_009872145.1.93600 WP_009872145.1.95142 WP_009872145.1.96955 WP_009872145.1.97423 WP_009872145.1.99598 YP_001654225.1.27483 gi|478456625|ref|YP_007727008.1| gi|478462938|ref|YP_007738759.1| gi|478461135|ref|YP_007736086.1| gi|478452999|ref|YP_007720747.1| gi|478464734|ref|YP_007741426.1| gi|478459330|ref|YP_007732514.1| gi|386263121|ref|YP_005816400.1| gi|237803195|ref|YP_002888389.1| gi|478472840|ref|YP_007733407.1| 272561.CT765 315277.CTA_0835 471472.CTL0134 471473.CTLon_0134 580049.JALI_7701 672161.CTB_7701 gi|478465634|ref|YP_007742316.1| gi|478455709|ref|YP_007727899.1| gi|482546171|ref|YP_007852087.1| gi|385243972|ref|YP_005811818.1| gi|478450298|ref|YP_007719855.1| gi|471328939|ref|YP_007540464.1| gi|478453912|ref|YP_007718074.1| gi|478447607|ref|YP_007716295.1| gi|385242161|ref|YP_005810001.1| gi|478468333|ref|YP_007743206.1| gi|527326322|ref|YP_008352515.1| gi|389859336|ref|YP_006361577.1| gi|478452099|ref|YP_007715405.1| gi|478454804|ref|YP_007717183.1| gi|385244852|ref|YP_005812696.1| gi|389860212|ref|YP_006362452.1| gi|478451199|ref|YP_007721641.1| gi|527327243|ref|YP_008353435.1| gi|389858460|ref|YP_006360702.1| gi|339625516|ref|YP_004716995.1| gi|478470142|ref|YP_007723422.1| gi|385245771|ref|YP_005814594.1| gi|527328169|ref|YP_008354360.1| gi|166154982|ref|YP_001653237.1| gi|478448500|ref|YP_007722534.1| gi|478463836|ref|YP_007739648.1| gi|478471933|ref|YP_007740536.1| gi|478449402|ref|YP_007724325.1| gi|527318614|ref|YP_008344816.1| gi|478457518|ref|YP_007726111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]