SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386312646|ref|YP_006008811.1| from Shewanella putrefaciens 200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386312646|ref|YP_006008811.1|
Domain Number 1 Region: 5-321
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.09e-124
Family TK-like PP module 0.000000000231
Further Details:      
 
Domain Number 2 Region: 338-525
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.37e-62
Family TK-like Pyr module 0.00000019
Further Details:      
 
Domain Number 3 Region: 534-663
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.66e-44
Family Transketolase C-terminal domain-like 0.00000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386312646|ref|YP_006008811.1|
Sequence length 664
Comment transketolase [Shewanella putrefaciens 200]
Sequence
MSSRKVLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLKHNPNNPKWVDRDRF
ILSNGHGSMLIYSLLHLTGYELPIEELKQFRQLHSKTPGHPEYGYTPGVETTTGPLGAGI
SNAVGMAIAERTLAAQFNRDGHEIVDHYTYCFLGDGCLMEGISHEACSLAGTLGLGKLIA
FWDDNGISIDGHVEGWFTDDTPKRFEAYGWHVIANVDGHDSDAIRAAIEAAKAVTDKPTM
ICCKTIIGFGSPNKSGSHDCHGAPLGDAEIAAAREFLGWPHAPFEIPADVYAGWDAKEAG
AAREAAWNDKFAAYAKAYPELAAEYERRVLKGELPADFEAKAQAFIQECQDKAEGIASRK
ASQNAIGAFGAMLPELLGGSADLAGSNLTLWSGSKGIQDDPAGNYVYYGVREFGMSGIMN
GVSLHGGFINYGATFMMFMEYARNAVRMSALMGIQNIFVYTHDSIGQGEDGPTHQPVEQL
ANLRMTPNMAVWRPCDAAETAVAWKAAIERRTAPTSLIFSRQNLKAQVRSAEQLANVAKG
AYVLQDCAGTPELILIATGSEVQLAMEAAAALTEQGKQVRVVSMPSNTEFDKQDAAYKES
VLPRAVTKRVAIEAAHTDFWYKYVGFEGTVVGMTTFGESAPGNVLLKHFGFTVENVLNAA
KSLG
Download sequence
Identical sequences A4Y3R8 E6XL88
WP_011918749.1.82224 WP_011918749.1.85280 319224.Sputcn32_0872 gi|386312646|ref|YP_006008811.1| gi|146291976|ref|YP_001182400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]