SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386313053|ref|YP_006009218.1| from Shewanella putrefaciens 200

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386313053|ref|YP_006009218.1|
Domain Number 1 Region: 9-349
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.77e-75
Family TK-like PP module 0.019
Further Details:      
 
Domain Number 2 Region: 291-480
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.04e-61
Family TK-like Pyr module 0.016
Further Details:      
 
Domain Number 3 Region: 493-620
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-30
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386313053|ref|YP_006009218.1|
Sequence length 622
Comment deoxyxylulose-5-phosphate synthase [Shewanella putrefaciens 200]
Sequence
MSLDISQFPVLAQANTPNELRQLPQALLPQVADELREFLLKSVGMSSGHFASGLGTVELT
VALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDKMHTIRQKNGLHPFPWREESEYDTFSV
GHSGTSISAALAMAVAAEKEQAGRKVVAVIGDGAMTGGMVFEAMNHAGDLHNDMLVVLND
NEMSISENVGALNNHLAQLMSGRFYTTLREGGKKVLKGMPVIKEMAKRTEEHLKGMVVPG
TLFEELGFNYIGPIDGHDVDALVETMRNMRNLKGPQVLHIMTKKGRGYEPAEKDPIGWHA
VPKFDPTQFKKPSTTPGLPTFSQVFGKWLCDIAEQDDKVLGITPAMREGSGMVEFSQRFP
NQYFDAAIAEQHAVTLGAGFACEGYKPVVAIYSTFLQRGYDQLIHDVALQRLPVLFAIDR
GGIVGADGPTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYCYNAGPSAVRYPRGS
ATGATQVEAMTALPIGKGVIKRVGKRIALLNFGTTLASALTAADNLDATVVDMRFVKPLD
AELVTEMAQTHDILVTVEENAIMGGAGSGVLELLQKLKMPKPVLQIGLPDEFIKHGSPEE
VTHDLQLDAEGILAQINAYLAQ
Download sequence
Identical sequences E6XQC8
gi|386313053|ref|YP_006009218.1| WP_014610171.1.85280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]