SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|565641951|ref|YP_008892591.1| from Francisella noatunensis subsp. orientalis LADL--07-285A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|565641951|ref|YP_008892591.1|
Domain Number 1 Region: 10-368
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 3.53e-111
Family ArgJ-like 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|565641951|ref|YP_008892591.1|
Sequence length 371
Comment amino acid acetyltransferase [Francisella noatunensis subsp. orientalis LADL--07-285A]
Sequence
MESLFRTKLPKGFLTGGVNCGVRLYRPDLGVIISEKNCKAVGVFTKNKCKAAPVKYCMNL
LPAGNIKAIITNSGQANAATGEIGDKHNQQVVDSLATELNCSSEQVLIASTGVIGQQMSI
DKITSAIPKLVNSVSNIADKFAISILTTDLLPKSVYKKIQLSTGEITITGICKGSGMINP
NMATMLGYFLTDAYIDIHLAQEILRESSDNSFNMISVDGDMSTNDCVHEIAVILAKNIAR
DGEGATKLIEAKVTGLNDETLSKELAKKIISSSLVKTAIYGESPNWGGVLAKIGEVDIDE
QTLESCQIFMQGQKIFANGLPVSDDLTNLKNTMKEDTITIDVKFSQGNQQAIAWGCDLTQ
QYVNINAEYLS
Download sequence
Identical sequences I2AXB1
gi|565641951|ref|YP_008892591.1| WP_014714358.1.21969 WP_014714358.1.36379 WP_014714358.1.38482 WP_014714358.1.41272 WP_014714358.1.49925 WP_014714358.1.70881 WP_014714358.1.71620 WP_014714358.1.95278 gi|387885985|ref|YP_006316284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]