SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|565642008|ref|YP_008892662.1| from Francisella noatunensis subsp. orientalis LADL--07-285A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|565642008|ref|YP_008892662.1|
Domain Number 1 Region: 121-339,373-513
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.73e-45
Family AAT-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|565642008|ref|YP_008892662.1|
Sequence length 526
Comment aspartate aminotransferase [Francisella noatunensis subsp. orientalis LADL--07-285A]
Sequence
MSQQDLSPFEFKDELIKLATSKADRLMLNAGRGNPNFLATVPRHAFLHLGDFALKESERS
YSCLDNIFGGLPEKKGMLERFDFYCMANDKLDGISFLKAAISFVDDHLGINKEDFLYEMT
NAYLGCNYPSPPRMLSITEKIVMHYLREELYKNTDIPLEFDIFATEGGTAAMTYIFQSVK
INGLLNANDKIVMISPIFSPYLEIPELPEYNNTIVHIYADEQADWQVTDKELEKLLDPTI
KILCLVNPSNPPSVKISDAVLEKIAKIIEDHRSDLMIITDDVYATFSDDFESLFSKCGYN
TLCVYSFSKYFGATGWRIGTIALHKDNIFDKMISELDDKKLQELDKHYSSLTTNSRTLKF
IDRLVADSRSVALNHTAGISLPQQLQMSLFALSSLLDNQDIYRKEAKKLIRRRYNILFNS
ISPKIQHRYNSDNVGYYTLLDLEHLSTVIYDKFFSKWLIQNHSVNDMLKTLASEMGIVLL
PGNGFDDLHPSARVSLANLRECDYRNIGSNIRQQLDNLYSKYKKSC
Download sequence
Identical sequences gi|565642008|ref|YP_008892662.1| WP_030003354.1.21969 WP_030003354.1.36379 WP_030003354.1.38482 WP_030003354.1.41272 WP_030003354.1.49925 WP_030003354.1.70881 WP_030003354.1.95278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]