SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336179580|ref|YP_004584955.1| from Frankia symbiont of Datisca glomerata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336179580|ref|YP_004584955.1|
Domain Number 1 Region: 42-351
Classification Level Classification E-value
Superfamily Aldolase 2.56e-98
Family HMGL-like 0.000000000615
Further Details:      
 
Domain Number 2 Region: 476-577
Classification Level Classification E-value
Superfamily 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 1.1e-36
Family 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 411-460
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.0000000000000051
Family DmpG/LeuA communication domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336179580|ref|YP_004584955.1|
Sequence length 594
Comment 2-isopropylmalate synthase [Frankia symbiont of Datisca glomerata]
Sequence
MTTSRQFPGSHIPGAQSPGSQRPSGMPVDKYRPFVPVDLPDRTWPNRTITRAPRWCSVDL
RDGNQALIDPMTPARKTQMFQLLVRMGYKEIEVGFPAASQTDFDFIRQLVEGGHIPDDVT
VQVLTQAREELIERTVRAVVGAPNVLVHLYNSTSTLQRRVVFGLDRAGITDIAVQGAQWC
ARYAEKLLAGTDVRWQYSPESFTGTELDYALEVCEAVMDVWQPTADRPVVLNLPATVEMS
TPNVYADQIEWMSRNLTRRDAVVLSLHPHNDRGCAVAAAELGVLAGADRVEGCLFGNGER
TGNVCLVTLGMNLFSQGIDPEIDFGGIDEIRRTVEHCNQIPVHPRHPYGGDLVYTAFSGS
HQDAIKKGFEAMERTGQRLWEVPYLPIDPKDVGRSYEAVIRVNSQSGKGGVAYLLKAEHS
LDLPRRLQIEFSHVVQRHTDDIGGEVTGEELWEIFSREYFLTGDASDAPLELLGSRTTAA
HGERDEVRVSVRIHGGEEVLSGTGNGPIDAFVAALRTRDVEVRVLDYHEHALGSGADARA
AAYLEVAVGDRVFWGVGVDPNIVTASLRAVVSAVNRAARDQQRIAPGIQAATGI
Download sequence
Identical sequences F8B512
gi|336179580|ref|YP_004584955.1| WP_013874914.1.39566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]