SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336179975|ref|YP_004585350.1| from Frankia symbiont of Datisca glomerata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336179975|ref|YP_004585350.1|
Domain Number 1 Region: 12-51
Classification Level Classification E-value
Superfamily YefM-like 0.000017
Family YefM-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336179975|ref|YP_004585350.1|
Sequence length 98
Comment prevent-host-death family protein [Frankia symbiont of Datisca glomerata]
Sequence
MTAAADDGRLRVGMRELSQRTARVLALVRAGETVEVTDRGRTVARIVPAADDRYEQLVAA
GLIRRAARPFSLAHLPEPAANPTGRSSDEWLTDLRGEG
Download sequence
Identical sequences F8AWY5
gi|336179975|ref|YP_004585350.1| WP_013875297.1.39566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]