SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336180157|ref|YP_004585532.1| from Frankia symbiont of Datisca glomerata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336180157|ref|YP_004585532.1|
Domain Number 1 Region: 8-180
Classification Level Classification E-value
Superfamily Prim-pol domain 3.33e-19
Family Bifunctional DNA primase/polymerase N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336180157|ref|YP_004585532.1|
Sequence length 292
Comment bifunctional DNA primase/polymerase [Frankia symbiont of Datisca glomerata]
Sequence
MSHPPDPRQAAAVAYAAAGRAVFVLGRSKRPVANCPACATAAPDHDRDGCACLTCHGFYA
ATTDPARIHAMLTTIPAGLLAVRTGAVSGLVVVDIDPGHGGRLDRTLMTPTATVATGGGG
WHLYYQHPGTPVLSRPLPGHVGIDIKADGGYVTAPPSTHPTTGRPYQWVGTRPVNEMPPA
LLTLCQTPPAPPHPFPAAPAPRPTHGKGGGGISYPDRLLTAHLDAVARAPEGRRRTTLYG
AARGIARMITAGVISLEDARAALTAAGRAAEQTDRDIHAAITGGFRDEGLTP
Download sequence
Identical sequences F8AYN6
WP_013875471.1.39566 gi|336180157|ref|YP_004585532.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]