SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr11_P32253 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr11_P32253
Domain Number 1 Region: 95-170
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.22e-19
Family Skp1 dimerisation domain-like 0.00032
Further Details:      
 
Domain Number 2 Region: 26-89
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000165
Family BTB/POZ domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr11_P32253
Sequence length 175
Comment skp1-like protein
Sequence
MSSEGKEVITEAAEGSSSQPKPRKTVVTLVSSDEQKFEVDMALANQSEMIKNLILDMEDD
VDEFVVPVLNVTGLVLAKVIQYWKQHAEANDRDRLDALDKAFVDMHKELLFQVLIAVNFL
ESRQLLNLLSKTIADNIKDMSVEEVRAYFSIESDFTEEEERQVRAENQWAFEQQD
Download sequence
Identical sequences ITC1587_Bchr11_P32253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]