SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr11_P33903 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr11_P33903
Domain Number 1 Region: 122-182
Classification Level Classification E-value
Superfamily DNA-binding domain 1.9e-23
Family GCC-box binding domain 0.0000249
Further Details:      
 
Weak hits

Sequence:  ITC1587_Bchr11_P33903
Domain Number - Region: 49-151
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.00668
Family Antibiotic resistance proteins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr11_P33903
Sequence length 295
Comment ap2-related transcription factor
Sequence
MSRAEELALLEAVRHHLLVDVDDSNPDPKVSSSARAYCRSSSFGSLVADLWSDGLPFRLD
DSDDMVVYGALRDAFHHGWLPSGAKPEPPAEDEGELPPPLAVQVGQQQKQAPLRAAPAKG
KHYRGVRQRPWGKYAAEIRDPARNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFP
LRIGSEEAAAMATSPVPSPSKRASPEPSSSSSSSTSSSSYSSSTSSSSSSSSPKRRKRGE
ATDAAAPTSPSPAPVLCPVPVAVQGQTGLGFTNRPEIFPAGPVAQLPHPGQLLVT
Download sequence
Identical sequences ITC1587_Bchr11_P33903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]