SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr1_P01310 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr1_P01310
Domain Number 1 Region: 200-255
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.06e-22
Family Skp1 dimerisation domain-like 0.0000826
Further Details:      
 
Domain Number 2 Region: 3-63
Classification Level Classification E-value
Superfamily POZ domain 3.05e-21
Family BTB/POZ domain 0.00032
Further Details:      
 
Weak hits

Sequence:  ITC1587_Bchr1_P01310
Domain Number - Region: 78-101
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000746
Family Skp1 dimerisation domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr1_P01310
Sequence length 257
Comment skp1-like protein
Sequence
MEKKITLRSSDGEVFEVDVAVAMESQTIKHMIEDDCAENGIPLPNVNAKILAKVIEYCRK
HVDAAASKSSDDASKVADEELKAWDAEFVKVDQATLFDLILHQVKKHNKVDDKLGEGLPG
IGLFAFTRIEWWILTFGGVDVVIISEPEDVTGPPYFMNALMGPTGYKNLFVYDGVKGTEA
RPVKDIRTKGGSTGLDVFNHAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDF
TPEEEEEVRRENQWAFE
Download sequence
Identical sequences ITC1587_Bchr1_P01310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]