SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr1_P01349 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr1_P01349
Domain Number 1 Region: 19-77
Classification Level Classification E-value
Superfamily DNA-binding domain 5.69e-24
Family GCC-box binding domain 0.0000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr1_P01349
Sequence length 118
Comment at1g04370
Sequence
MADSTWGGGGVEKEGEATRYRGVRRRPWGKYAAEIRDSAQHGARVWLGTFDTAEEAARAY
DRAAFAMRGSLAVLNFPGEAGAGSSRAGNQVIELECLDDRVLEELLEVAEKEKKSKKK
Download sequence
Identical sequences ITC1587_Bchr1_P01349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]