SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr2_P04741 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr2_P04741
Domain Number 1 Region: 90-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.7e-18
Family Skp1 dimerisation domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 17-80
Classification Level Classification E-value
Superfamily POZ domain 0.0000000118
Family BTB/POZ domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr2_P04741
Sequence length 306
Comment skp1-like protein 21-like
Sequence
MSESEKAIIKPEVMKSFIWLQCADGSIQQVEEEVAMFCPMIYREILRTGMGSSKNYAISL
PERVNPAILSLIFDYCRFHQVPGRSNMERKSFDEKFIRMDTKRLCELTSAADSLQLKPLV
DLTSRALARMIEGKTPEEIRETFHLPDDLTEEEKLEPLKNVNDDPRIRLLNRLYARKRKE
LKDRQKLKNTEVKEEKKDERSVDEILSFINGDEDSKGVKAIKNKKKNRKKKDLPKDISRN
DPAKVHKKKEATFSPSPSQSSEAQENDEVAFASNGEFEDGDIDDELDPAVKEELDRLVLF
VLLHDC
Download sequence
Identical sequences ITC1587_Bchr2_P04741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]