SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr8_P22614 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr8_P22614
Domain Number 1 Region: 126-196
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.05e-20
Family Skp1 dimerisation domain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 19-76
Classification Level Classification E-value
Superfamily POZ domain 0.000000122
Family BTB/POZ domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr8_P22614
Sequence length 199
Comment kinetochore protein
Sequence
MKREGEASESPPLAKKKKEITLRSSDGALLSADEFLAEQSAVVRKAINSNPADIALNVPS
VTESVLHLVMEFCKKQAEFTAEINVAAIAGKKAKGVVVDSVDNTTEGKDAIAVDNGMAAI
EKKRRDWEEDFLSVDHDVLYYLIMAADDLEIDSLRNLTCGKLADLTKNKSPEQIRGMLGI
DDDFSEEEKQEIKKELQLF
Download sequence
Identical sequences ITC1587_Bchr8_P22614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]