SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr8_P22616 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr8_P22616
Domain Number 1 Region: 10-72
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.7e-24
Family Skp1 dimerisation domain-like 0.0000922
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr8_P22616
Sequence length 74
Comment skp1-like protein 1b-like
Sequence
MVENGGTWYQMMWEWQKAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPE
EEEEIRRENQWAFE
Download sequence
Identical sequences ITC1587_Bchr8_P22616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]