SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr9_P27713 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr9_P27713
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily POZ domain 1.18e-21
Family BTB/POZ domain 0.00042
Further Details:      
 
Weak hits

Sequence:  ITC1587_Bchr9_P27713
Domain Number - Region: 81-104
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000157
Family Skp1 dimerisation domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr9_P27713
Sequence length 196
Comment skp1-like protein
Sequence
MAKAIMLKSSDGEVFEVDEAVAMESQTIKHMIEDDCAENGIPLPNVTSAILAKVIEYCRK
HVEASAAAASKSSDDGSKPTDEELKSWDAEFVKVDQATLFDLILFGSAFTRVGGIDLGMV
DLLLVGRQMSSVLVIECGLIINCLSSIGLAVTGMSLKDYILMIIGQWQIAASVGPLILIA
NHLLMMADSRSRLHAS
Download sequence
Identical sequences ITC1587_Bchr9_P27713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]