SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr10_P30636 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr10_P30636
Domain Number 1 Region: 159-263
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.15e-32
Family B3 DNA binding domain 0.00000937
Further Details:      
 
Domain Number 2 Region: 53-109
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000000268
Family GCC-box binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr10_P30636
Sequence length 323
Comment ap2 erf and b3 domain-containing transcription repressor tem1-like
Sequence
MEGRCVEEASSDWVKRLHVSKVLQRMGSGVSVVLDPSAEGGGIEAESRKLPSSRYKGVVP
QLNGRYGAQIYERHQRVWLGNFGDEAEAARAYDVAAQRFRRCDAVTNFKPLTESNDEEAA
ELSFLVAHSKAEIVDMLRKHTYHDELQQSKQALHSAREILFDKVVTPSDVGKLNRLVIPK
QHAEKHFPLKNGSSVARNGVLLNVEDASGKMWRFRYSYWNSSRSYVLTKGWSRFVKEKSL
KAGDMVSFWRSTGPEKQLCIDWKTSPVACNRAVPPAIRPLPVVKLFGVDISGVPASGGDG
KRGREMELFPPPQFFKKQFVEAL
Download sequence
Identical sequences ITC1587_Bchr10_P30636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]