SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr10_P31184 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr10_P31184
Domain Number 1 Region: 130-237
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.16e-41
Family B3 DNA binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr10_P31184
Sequence length 610
Comment auxin response factor 3-like
Sequence
MGIDLNTIEEEAEEAEGKMAAVEGRGGESVCLELWHACAGPQIWLPRKASLVVYLPQGHI
EQLGGAGGDGDWLGPSDVPPHVLCRVAAADTDEVYAQLSLVADCKELEQHLRDDETVESR
RVEEADGFSKSHTTHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYKQLRPLQELVAK
DLHGTEWRFRHIYRGQPRRHLLTTGWSAFINKKKLVSGDAVLFLRYTYLSCTCFLQFRAN
DGELRLGIRRTDQLKRSIHSAAFSSQKNLGKLTDVANAVSARTVFCINYDPRASRSGFII
PYWKFTKSFCHSFSTGTRFKIQIDSEDAAEKRCTGLITGIGELDPLRWPGSKWKCLSVRW
DGEVDMAGANRVSPWDIEPTGSGLVSDVPPPTAPKKYKISHPPDHLDHPIPNGVGYPDLV
EPARFLEVLQGQEIMGLGTLYEGIDVTQFKVFGEYVRLQKVFQGQEMHPPMSTRVLSHLL
GTGSSWVRSIHEFSGLGTPFTSSTQVSSPSSVLMFQQASAQLPCPPALHGMDMYGMEKQM
PSYDLARKPCGSAEANETDHVWKKDSKGDHNVLPGGKRNCRLFGFPLTEMITVPNGIDGC
ETAGSSAKQT
Download sequence
Identical sequences ITC1587_Bchr10_P31184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]