SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr11_P33945 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr11_P33945
Domain Number 1 Region: 66-157
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-28
Family B3 DNA binding domain 0.0000218
Further Details:      
 
Domain Number 2 Region: 813-884
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000667
Family HLH, helix-loop-helix DNA-binding domain 0.0043
Further Details:      
 
Domain Number 3 Region: 206-215,393-413
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000863
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr11_P33945
Sequence length 1029
Comment transcription factor bhlh70-like
Sequence
MEFTRGRDMSRMTEQQDAWKHASFVPSSTSSSSSPSLPPSSFAPFRWNDGSSGSSGRGEE
SCVEKEHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPLDAGDNGKGLLLSFEDRNGESWRF
RYSYWSSSQSYVMTKGWSRFVKEKRLHAGDTVSFGRGLGDSGRDQLYIDWKRRPGNHDAA
RMPQIYFPGVSFARSVGRLGTHLFMPPPPPPPPPPTAYDQHLQGYGCNVMSPGALGGQLI
FFQSPLTAPPPVEMHSGGLSMVLDPAPVVHNQATAKNVRLFGVNLVCAGSEDSSKAVNST
FLKVEDGRTGLVQQSVENTEASGNGDEHGNKLFHHQLELSKRVGEGAHRDVCPGFMLGHT
ADDENVRLILQEQSAGFGVSTGHGKAFLGDNMLTWNQFNNRKKNEYADPDEEIRLRENRK
KDSKEDDAPVIEDVKDDDGDDEDGDDDDGDAEDSSDVFLSFFVEYAVGDHKAGADNSSKQ
SRSEKKSRKAMMKLGMKPVTGASRITIKRTKTPDVFKNPNSDTYVIFGEAKIEDLSSQLL
NNSEFQTSATWWPRLFGIIDPLLFPPFTSCICLRHIKVDQYPLLCLMQPNVPQTMWLSPH
YPLVNCCIPDLSPAFILHPKVQTCEMGRRGRTRVLNDFDTSSASIYCSWQVESAGDGLSS
KCVEPGTATASFSDHLKMSCGSLSSHQTPVLRLLQGAMQAGEEMVEEEVQLHLQQYQHRR
FFTSYPQETNFQLLRRMQSQCHFRQLRMAEMDRSCAVEQLESCVTHVSESETRGIVHRED
PATAAATGPMRSLAAAGSNERRNRKRQRPASASKSAEEAESQRMTHIAVERNRRHLMNVH
LATLRALMPPSFVQRGDQASIIGGAIEFVKELEQHLLSLRAQKRFRESAFARSSSDDDDP
CRATLPLLHDDFLISPQYTGYSQSQRRRRDGNGEEPHQEDWTGVDVEATLVQGHVNLKVA
GRRQRGQLVRAIAAMEELRLSILHLNITSLGPSSILYSLNLKMEEECKLGTADEIATAVH
QIFSYNSNC
Download sequence
Identical sequences ITC1587_Bchr11_P33945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]