SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr1_P01761 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr1_P01761
Domain Number 1 Region: 99-138
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000883
Family Type II restriction endonuclease effector domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr1_P01761
Sequence length 140
Comment auxin response factor 4
Sequence
MSSIQTNVQVSGLKNAAALLDEMKLLGEVPSKPSARKVLNSEFRHACAGPLVSLPQPGSL
VYYFPQGHSEQADKETDEIYAQMTLQPENDVFPIPDLGHIRCKHPTEFFCKILIASDTIT
HGGFSVPRRVAEKPFPQLVK
Download sequence
Identical sequences ITC1587_Bchr1_P01761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]