SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr1_P01763 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr1_P01763
Domain Number 1 Region: 136-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.19e-41
Family B3 DNA binding domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ITC1587_Bchr1_P01763
Domain Number - Region: 911-966
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000196
Family PB1 domain 0.03
Further Details:      
 
Domain Number - Region: 1811-1963
Classification Level Classification E-value
Superfamily TPR-like 0.0114
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Domain Number - Region: 1281-1462
Classification Level Classification E-value
Superfamily HCP-like 0.0249
Family HCP-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr1_P01763
Sequence length 2132
Comment pentatricopeptide repeat-containing protein mitochondrial-like
Sequence
MSSVQANVRAAGLNSAAALLDEMKLLGEVPSKPSARKVLNSELWHACAGPLVSLPQPGSL
VYYFPQGHSEQVTASTRKIANSQIPAYTDLPSQLMCQVHNVTLHADKETDEIYAQMTLQP
ATCENDVFPIPDLGHTRCKHPTEFFCKILTASDTSTHGGFSVPRRAAEKLFPQLDYSMQP
PNQELIVRDLHDNLWTFRHIYRGQPKRHLLTTGWSLFVGAKRLKAGDSVLFISAYRDEKS
QLLLGVRRANRKQTALTSSVLSTDSMHIGVLAAAAHAAANRSPFTVYYNPRACPSEFIIP
LTKYHKAAYTQVSIGMRFGMMFETEESSKRRYMGTIVGISDYDPVRWPNSRWRNLQVEWD
EHGYGERPDRVSLWEIETPESLFAFPNVTSSLKRQCLPGYVGPAINNHFVNLKSFPKPTE
DGNVDTQHFFAGLGSENLLRLLNKPCNPNRDGLLAHHQSIYASILQNVRNSELSRSFSVT
MPALHTVGSSTQQEVVTTAAMQQKQHFSPQQGMDPLQNVVSQEHRLYLVPTQGIKLDFIS
GTHVKSQVSDSEEARPAEHEQNFQDHNARVENGINLQGSEDSSLHESIPQQSDVASVAFP
GDLDSQSDGMIKTISHDMLAEHVDQLSKHQNGESSTSTGPFDRVNLAAQISANPALQVKE
QSDHKLVQQQNDPSRTQSPGLHAAQSSDMCNLNYLLPHQDCSHPILDNDDWMTQHSCLQS
FMGSSKTPEFPYINTENATTSSADISSMANPNNFEPTETFQLSCISDSGTPQRITTDIQE
FLGTQLNSLDDELLVQGILSSEVHNLDVQGDCTVLQGVSNSCGVMDLSEESNNQGETISN
LHFDPSNESMDMGHVPGVAIDGLSPIGSSRNQCLTLLQKEYQTQYSRYKMSLTALQVQKV
GSVGRSIDVTRFSNYCELRSAVACMFGLEGQLDDPRGSEWKLVYVDYENDVLLVGDDPWD
KRANLFDEMTGRHEELERLDGAARLPQRRGAALVQCVDRVHQIEYRVVEGKSLSRREEQR
VEAPSRHELLHHTRVSCIKADLDPTIAQTELSTPQRLIKAGLTAPSVRSFNLLLSFLLFE
ARKPRLVLRLFSQITSNSLPVDPRTHSLVARALVRSRRFHDASRFISRAPLDFGFRRSLV
ESLIRRLCVAERNPDGALCLLQECVRNRGVFPSLGSFRSVVAAFCSLGRLDRAVEVLEAA
ADKKDRILTDNFVCSSIISGFSRIGEPALGLEFYERARKVDGFLPNLVTVTTVVDALCRE
GRINEACDLVRNMEDQGMALDAVLYSCLIDGYLKRGDLMEGLRKHKLMVDKGITPDVVSY
TSIIDGLCKEGNVEKVIGFLEEMESKGAHANVVTYTAVIRGFCRRNKLEEAFHALRKVEE
LGFVADEFAYSVLIDGLCRKGDLDRVFSLLEELEKKEIKVGTVTYNTLINSLCKAGQASK
ANEISKGFAGDNFTYATLLHGYLKEMDVAGILEVKRRLDESGIVPDIVTCNVLIKALLMA
GMIQDGCKLFDELPEMGLSANSITYCTVIDGYCKVGLIEKALMVFDEYRRDSLFVSASTH
NCIIRGLCRQNMSEIAMEVFEDLVERNLSPDLITCRMLIQAIFGKGDGEAVLRFIHRMEK
LEPELLVLICNEALVFLCTKGCFSAAWDVYILLRIRFLAVMSKSYNILLKSLLRIGDKQI
AELVISEFIKIYGTFEPQMINAMFLYLSKKNVEKAIHFLNIKRKGIISVGALTTVIDTLK
KEGRVEDAYQFLLQSEENGVPVDVFVYSLVVDGLCKSGYLERALDLCGRMKKKGIYPNVV
IYNSVINGLCQQGCLTEAFRVFDSLEKLSVPPTVVTYSTLIGALSREGFLDDASQLFKRM
ISKGIIPNTSVFNKLITGYCNCGLVEEALDLLSDLEKNCLSPDDYTIGAILNGFCQRGDI
EGALGFFTENKTRGYFPDFLGFMNLVEGLFAKGRMEEARSILRVMLKHAEIVDLINNAGD
ELHVESLDSLLSLACEQGRIKEVTLVLNEISYLSISSTRSNSGRVFLKLKELHGSGVVDT
ENKIDGRGAQHLLFADVHATNIKDGFREKVDGDSDKEINEYLMGKPLGYDFATYYSIISL
LCQQGDLQKANEAARTILQNPEKVFNPSIPTL
Download sequence
Identical sequences ITC1587_Bchr1_P01763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]