SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr2_P04515 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr2_P04515
Domain Number 1 Region: 511-633
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-19
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr2_P04515
Sequence length 684
Comment sulfate transporter
Sequence
METHSSSASGGGVARVASSSSLGGGGGRAVKVIPLQNPAPPSPYLQSAALASRWAAKVRG
MSALAWLELLLPCSRWIRTYRWREYLQADLMAGITVGVMLVPQAMSYAKLAGLQPIYGLY
GGFVPVLVYAVFGSSRQLAVGPVALTSLLVSNVLSPIVDSSDELYTELAILLALMVGILE
CLMGLFRLGWIIRFVSHSVISGFTTASAIVIALSQSKYFLGYSIVRSSKIIPLVKSIIAG
ADDFSWPPFVMGSIFLTVLLTMKHLGKSNKNLRGVRAAGPLTAVVLGTIFVKIFHPSSIS
VVGEIPQGLPKFSIPRGFEHVKSLISTAFLITGVAILESVGIAKALAAKNGYELDSNQEL
FGLGVANICGSFFSSYPSTGSFSRSAVNNESGARTGLSGIIMGIIMACALLFLTPLFTEI
PQCALAAIVISAVMGLVDYEEAIFLWCLDKKDFLLWTITFITTLFFGIEIGVLIGVGVSL
AFVIHESANPHIAVLGRLPGTTVYRNILQYPEAYTYNGIVIIRIDSPIYFANISYIKDRL
REYELDLDGSTKRGPDVGRIYFVIIEMSPVTYIDSSAVQALKDLNQEYRSRGIQIAIANP
NREVHLLLSRSSLIEMIGKEYFFVRVHDALQVCLQHVQSLNPSSPKVSSGHTPPRTLSFL
QSIWKQGSDGSTPEAEPLLPRNEV
Download sequence
Identical sequences ITC1587_Bchr2_P04515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]