SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr2_P04692 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr2_P04692
Domain Number 1 Region: 82-178
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000981
Family B3 DNA binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr2_P04692
Sequence length 358
Comment b3 domain-containing protein os04g0386900-like
Sequence
METGTHHPSSPGDNRVVAFHRRPQQDVKEQRKVCGEEKSSNCSLRLLMDSSRGKNCESGG
DAELSPAEPPASAEKDEIVPLSGNPFLTFVVSWSHVHDPYQVLFPRRFYPFLPATCVPVT
LSYGNRTWKMKYSCKGILRRLCSGWKNFALDTDLKVGDGCVLELMDSNNILFKVQILRRG
VVPVKSDKGLGLTSTSMIYDNCRRTRSIFDVVVRVVQSIQRKDMEAGRSIGNSVLRWLDP
TKPSAQVGVHSGKPPISSICISKYAASRSQLLRTGRSIVRITDQVKRGRSFFTPWNIPMK
TFPTIGMMMQPMKPAGLNGQYRHASQYIPNSSAIGHSRIIGGAEGVLRKDIAQWMLHT
Download sequence
Identical sequences ITC1587_Bchr2_P04692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]