SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr4_P08726 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr4_P08726
Domain Number 1 Region: 241-344
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-30
Family B3 DNA binding domain 0.0000152
Further Details:      
 
Domain Number 2 Region: 112-168
Classification Level Classification E-value
Superfamily DNA-binding domain 6.54e-16
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr4_P08726
Sequence length 410
Comment ap2 domain-containing transcription factor
Sequence
MEVKQMRQWPLNAPNRLLSDGRPPCQGLTPKSLVATVVRIWCMVDLHGAIQSFLGGPLNS
RLCRSSIEEACEETREWPPVASKSLQRVGSGGSEVIDPEGCVEAESRKLPSSKYKGVVSQ
PNGRWGAQIYEKHQRIWLGTFSEEAQAALAYDVAVQRFRGRDAVTNFKPLNDADDEDAAE
LFFLDSHTKHEIVDMLRKRTYHNELQQSKRSIGADNKKGIAGRSNAAVAGATDPLAGAQR
QHLFDKSVTPSDVGKLNRLVIPKQHAEKYFPPQKTGGAASKGVLLSFEDGCGKEWRFRYS
YWNSSHSYVLTRGWSRFVKEKHLEAGDVVTFQRSTGTDKQLFIDAKARSGVQVLRLFGVN
IVRGPAAAIGEGGVDDDNSVFCATGKKNRDHSTELVPSQGMFKKQRTEAL
Download sequence
Identical sequences ITC1587_Bchr4_P08726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]