SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr4_P09340 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr4_P09340
Domain Number 1 Region: 526-591,624-859
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.01e-49
Family WD40-repeat 0.00023
Further Details:      
 
Domain Number 2 Region: 29-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-25
Family B3 DNA binding domain 0.0012
Further Details:      
 
Domain Number 3 Region: 240-342
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-20
Family B3 DNA binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr4_P09340
Sequence length 902
Comment vegetative incompatibility protein het-e-1-like
Sequence
MDEVDVRCLECRKWKQHYYWNHFEATKKRFFKVLIADFSRKLSIPRKFVLHFKDLPKDAK
LKGPSGNLWNVKLKRSGDDVAFTGGWSKFAEDHLLERGDFLVFRYIGDSCFKVLVFDKTA
CEKEHSYFIGEKTAAEVGSACPSRGSKHESVEPPLEDDQKCSDDESANAAAEHASDRNPI
MSAGKECSFRRSVIRQQPRRRSCRRRTSASPAEHHIDNSNPQRPATVEEKQRALSLARSM
KTAHPSFIAELRQSNVSQSYVLVIPHGFAVQNMPGCDQSVLLRLPSGGTWQVNYIVHYKA
TKFGSGWRQFVVDNELEKDDVCLFEIIRAKNYDLVLEVNIFRAVPPAIVLPTELSTEGKG
KTKGRDPIEKDMLLGGSMLRTELLVMEKLYIPSFLVSSPYLSFFRPSSTTFNTCPSTSFL
PFPSAKTLMGEGAGSSLGSSHGATYANVHQSSADDDFPRQSTSSATAGSGFDSDYTVATS
GESSPFISSPWHQSAPYPPYDPASGDADAAALPCTGLIGSLVREEGHIYSLAATGGLLYT
GSDSKNIRVWKNQKDFAGFKSSSGLVKAIVVASDRIFTGHQDGRIRAWRVSPKDATVHKR
IGTLPRLKDVLRSSLNPSNYVEVRRNRSALWIRHSDAISSLSLNEDQGLLYSGSWDKTFK
VWRISDSRCLESVVAHDDAVNSVVAAFGGLVFTGSADGTVKVWRRELHGKGTKHTLVQTL
LKQEIAVTTLAASPTASIVYCGSSDGIVNFWEGEQHLSHGGTLQGHKMSVLCLAAAGNLL
LSGSADKSICVWRREGAVHTCLSVLSGHSGPVKCLAIETDDAGEGGGSSVARWIVYSGSL
DKSVKVWRVSEQAPTALLRGPQHVPVEPEDSGAYRGSNGGGSDQACGGAFEGSSMAQVRA
AA
Download sequence
Identical sequences ITC1587_Bchr4_P09340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]