SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr4_P10266 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr4_P10266
Domain Number 1 Region: 114-159
Classification Level Classification E-value
Superfamily SAP domain 0.0000000201
Family SAP domain 0.0037
Further Details:      
 
Domain Number 2 Region: 20-71
Classification Level Classification E-value
Superfamily SPOC domain-like 0.0000381
Family Ku70 subunit middle domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr4_P10266
Sequence length 224
Comment atp-dependent dna helicase 2 subunit ku70-like
Sequence
MTSGLGYDNSGVVPCQLANNILKNHALQRHYGILQALALDEDEMPDIKDETLPDEEGLAR
PGVVRVLEEFKIAVYGENHDQEEADSMSMRGSRSEASRKRKEMAETAERESSRYNWADLA
ESGQLKDLTVIELKYYLTAHNLSVTGKKEALISRILTHLGNLKKPKAFNLQRDTERFSCM
FIRGCSIESLHILNPISYHCALFNELVDNKIGSNTSYRHIHRLG
Download sequence
Identical sequences ITC1587_Bchr4_P10266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]