SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr4_P11036 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr4_P11036
Domain Number 1 Region: 86-159
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.89e-30
Family B3 DNA binding domain 0.08
Further Details:      
 
Domain Number 2 Region: 708-780
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000687
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr4_P11036
Sequence length 780
Comment auxin response factor 8-like
Sequence
MGCFLIVELDEEKRCLDSELWHACAGPLVCLPTAGTRVVYFPQGHSEQADVETDEVYAQM
TLQPLSPDLWNMPQYLQEEQKDAYFPMEMGIASKQPTNYFCKTLTASDTSTHGGFSVPRR
AAEKVFPPLDFSQQPPAQELIARDLHDVEWKFRHIFRANIFTEYNLIINLFLKFILGTQC
HRQKSLVSEAITSILPVMILHSGILHQTNKWNEKNQLLLGIRRANRPQTSTPSSVLSSDS
MHIGLLAAAAHAAATNSRFTIFYNPRSLCYSFYGCNFHRASPSEFVIPLSKYIKAVFHTR
VSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRTVQVGWDESTAGERQRRV
SLWEIEPLTTFPMYPSLFPIGLRRSWHPGASFPHDNREEFNTFMWPRGVTADQRMYSLNL
PSLGTGPWIQQRHETLLLGSEFDQYQAMCPLAFQDIRCGDILKQQFLQNQQPIQFLQQSC
TSSSLFKLQDNQQQIVNPQPQCLTENHRHPVPYQQLQPPHNEQQKQLPQEANVYTQAFTM
HNNHVQRQSALPSPLFENSTIPDSSLNFSSVPTPISDQDILGSAYREGNVGGSNYSRLNQ
SMISHPGQQSWELNFTKSQMISFDGAALLSSFPAKNSTVGNDNFTDSQTCTLFGFSKDSS
SLLNSALSNSGTVNDVSTMPYTNSCFQNSFYGYLDDSPSLLQGAGETDPQSQTFVKVYKS
GSVGRSLDISRFSNYEELREELGQMFGIEGLLEDPLRSGWQLVFVDRENDVLLLGDDPWE
Download sequence
Identical sequences ITC1587_Bchr4_P11036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]