SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr4_P11436 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr4_P11436
Domain Number 1 Region: 533-635
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000334
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 
Weak hits

Sequence:  ITC1587_Bchr4_P11436
Domain Number - Region: 787-876
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0104
Family Motor proteins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr4_P11436
Sequence length 1266
Comment probable sulfate transporter -like
Sequence
MAGATAAIEAGDLKDMVASSKRVECFADDTDLEASPRMPTPDMMAMEVHKVAVLRDRTGL
RSFRHSLSEVFFPDDPLHRFKNKPFFKKVVLALQYFFPIFDWGAHYNLKLLKSDAVAGIT
IASLAIPQGISYAKLADSSFVPPLVYSVLGSSRDLACGPLSIASLVMGSMLRDVVSPEDT
KEYLEVAFTATFFAGVFQAGLGLLRLGFIIDFLSKPTLTGFMGGAAVLVSLQQLKGLLGI
VHFTTKMAIIPVLKSVLDNRKEWSWQALVMGLSFLVLLLTARHISTIRPKLFWVSAAAPL
TSVIISTIISFVFRSHEKGISTIGFLPEGVNPSSINGSSINSLQASKLRLTMDSQEGIAV
GRTFASMKNYQIDGNKEMVAVGSMNLAGSCASCYVTSGGFARSAVNFNAGCKTAATNIIM
ASVVLFTMLLLMPLFHYTPNVILSAIIISAVIGLIDVRGAILLWKVDKFDFLACMSAFLG
VLLLSVPIGLSISVGISVLKILFHATRPNIAVMGNIPGTNSYRNLAQYKEATRMPSFLIL
GIESPVYFTNSVYLQERILRWIREEEERITNSNERPLKCIILDMAAVTNIDISGIESLKE
LKKTLDRRSLELVLANPVGEVSQKLSHSGAWELFGPECFYMTCDNTDIIDHLGNFTQHHN
YSGTLDLELGICCLCHFLRVLRYFSLVIIGFASLGGQHLKISVMGKSPAKWIKAVIFGKK
SSRSHTSKGKDGLKPGVDKEHFSGGEPSHVTVKSLAITQPVLVTNNSSGPSSENRTDSTL
VTGAVRVESQEIVESLGRACCYKSSSCLQGLSGEFKEESVCIYVQSRRVFCALKGIIRLQ
ALIRGHLVRRQAVTTLHCMWGIVRFQALVRGQRVRLSGIGLEVRTKYPQMKSVDDKKLDF
SKMQLSANQFVCKLLSALPVTKPVQIHYDPAEPNSVFSWLERWTSSQFWNPLPQSKKSVN
VKSRVRCSSAVESESVRLKSNVHKNVAAKVDVMTESERHKRVTRKMLSPPADSVVENPQS
EIEKVKRSLRKVSNSKKEPSEKPESENQKPTCTPRKVTNSLSDAPQVSNEHSSLKIKKDS
VVSIDSKLEIVAAVKSVPSGGPKNAVIDDSTAIKPHSPEEICKEESISNCDGELSLKDEP
TSNEIRKSSKRRASFPPKPEPFAENASQNAPRLPSYMATTESAKAKLRGQVSPRVGSDSA
ERYNMPRRHSLPTSTNGKLNLQSSRAHKLIQASCKDGIRNDRSFTSSRDGSEREILCCSE
CTGANK
Download sequence
Identical sequences ITC1587_Bchr4_P11436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]