SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr5_P11835 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr5_P11835
Domain Number 1 Region: 276-380
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-17
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 70-197
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000126
Family BTB/POZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr5_P11835
Sequence length 584
Comment npr1-1 protein
Sequence
MPNATEPSSTISFASSSYLSNCSSAYHAPVAAPIPPVQPAAPDGGTNLEVLSLSKLSSNL
ERLLVDTEFDCTDAEIMVEGAPVGVHRCILAARSRFFRELFSREGSGGAPREGKPRFDMD
ELVPGGRVGREAFMVFLSYLYTGKLKPAPQDVSICVDRFCAHDSCPPAIGFAVELMYASS
VFQIAELVSLLQRRLLNFVEKALVEDVITILQVASHSKLNQLLAHCVQRVARSDLDDIAL
EKKLPQEVADEIRSLRRKSQPKESNVTVDPVHDKRIKRIHRALDSDDVELVKLLLNESGV
TLDDTYALHYAAAYCDSKVIAELLDLGSANVNLKNDKGYTPLHVAAMRREPKVIVSLLTK
GASALETTADGQNAVRICRRLTRAKDYFTRTEQGQESNKNKLCIDILEREVRRNPMVGED
AVTSPLLADDLHMKLLYLENRVAFARLFFPAEAKVAMEIAHADTTSEFTGLYKSRSSSNL
RDVDLNETPVVQNKRLRSRVDALMKTVELGRRYFPNCSQVLDKFLEDDLPDLFYLQKGNP
DEQKIKKLRFCELKEDVRKAFSKDKAGSLLSGLSSLSFSSLPKD
Download sequence
Identical sequences ITC1587_Bchr5_P11835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]