SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr5_P12101 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr5_P12101
Domain Number 1 Region: 167-305
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-42
Family B3 DNA binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr5_P12101
Sequence length 1074
Comment auxin response factor 7a
Sequence
MKGLANGAAAHEVERKAINPELWHACAGPLVTLPLVGSLVVYFPQGHSEQVMAFFNTHSP
NLMFIGFGSYCKHLIRIDFINQIGFSFYSEQMCINVVGYTKVATSMQKDLDAHIPNYTSL
PSKLICLLHNVTLHVDPETDEVYAQMTLQPVNSYEKEALLASELTLKQTRSQTEFFCKTL
TASDTSTHGGFSVPRRAAEKIFPALDFSMQPPAQEIQARDLHENLWTFRHIYRGQPKRHL
LTTGWSLFVSGKKLFAGDSVLFIRDEKQQLLLGIRRANRQPTSISSSVLSSDSMHIGILA
AAAHAAANNSPFTVFYNPRACPSEFVIPFAKYQKAVYSNQIFLGMRFRMLFETEESGTRR
YMGTITGISDLDPVRWKNSQWHNLQVGWDESAAGERHNRVSIWEIEPVIAPFFICPPFFR
KRTRQPGMLAIFGKNQLLLKQKHKALDDDESSEMENIFKRAMPWLEEETCIKDSETQSTV
MPGLSLVQWMNMQQNPSLASRTPQTEYLCSLAGPVQNLGTTDLSRPLGLQASKLQQANMQ
FNASRMSQQVEELAKLSIPLNQVGAVSRQQMQDLSLQQKQQLVNQAVPSDERQNIIQPQV
LIQIQLQQQQHQPQQQPPTMIQNKELLQTSLRQNQQQHPQQLFLQQQKQQHQHQHQQLEQ
QYQPQPSRILAVNQQLSDQQQSSFSQPRMQQPPFPQIQESQKTLPDVLQQLLNSHSLVQQ
PMIPQPCPKATPARLQQSSHNQSQQKPQQQQILLGDLSGAILPATPATNLIPACGSSLLA
AEGTQSRFTNDIPFCSTSPSANNGAILPHSILNGIENYTLESTEKTSQSVITMLGPTSVE
NAAAIPNISKEFPKAVHSMKPLTPFSKVQNQGVIAPQTYVGNTAQMDYLDTTSSATSVCL
SQTDGPLHKIFPLSSFNQPSMLRVAPTYGDVQGTDPGDNVPFGDNIDSSLELPLTIDTML
ANSIDSGKYQNRITRDVVANYNASKDAQQELSLSMVSQAFGIPDMAFNSIDSTTNENVFL
TKSSWTPVPPPLQHMRTYTKVYKRGAVGRSIDITRYSGYDELKHDLARMFNIEG
Download sequence
Identical sequences ITC1587_Bchr5_P12101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]