SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr5_P12102 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr5_P12102
Domain Number 1 Region: 420-701
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.33e-68
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 19-156
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000000678
Family Universal stress protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr5_P12102
Sequence length 785
Comment u-box domain-containing protein 35-like
Sequence
MYCRRNPEQMEVDAGCPLVAVAIDKDKGSQNALKWAVDNLLARGQTLTLIHVKLTSQPSA
NLDDDGGFKEPTDHQSKELFLPFRCFCTRKDVRCKDVLLEDVDAAKAIIEFVSHAAIEKL
VVGASSKGGFVRRFKNHDVSASVTKGVPDFCTVYVIGKGKVSAMRNAVRPAPAVSPLRAQ
IQSEASLKPDSLPPRFLLGPKGPGEVALETHSMKHEDSVKSPYARGMRASTIADLSLSDT
DISFVSSGRPSIDQAYPPRLSNGSDGLDRSFEMALTPNNRSADSYSTGNEFSSFSQGSTG
TSWSSQTMEDVEEEMKKLRLELKHTMDMYNNACKEALSAKQKAMELQRWKVEEQRKLYEA
QMAEEAAVALVEKEKAKRRLAMDTARAENRIAELESQKRVDAQMMAIKDAHENNRTLDSV
PRADVRYRKYTIEDIEIATEYFAEHRKIGEGGYGPVYKCHLDHTAVAVKVLRPDAAQGRS
QFQQEVEVLSCIRHPNMVLLLGACPEYGCLVYEYMAHGSLEDRLFRRGNSPVIPWQHRFR
IACEIATGLLFLHRMKPEPLVHRDLKPGNILLDRNYVSKIGDVGLARLVPPSVADSVTQY
RITSTAGTFCYIDPEYQQTGMLGVKSDIYSLGVLLLQIITAKPPMGLTHLVSRAIEQGTF
AEVLDPAEPDWPVEAAQRLAEKALKCTELRRKDRPDLEKVLLPELQWLSSLGEDSLANCM
LRCSTRSSPIHSQASMQEFMSDPLLTQNGFAIHSSESSATGRKSSVLHLYDQAAKAGLIA
KDSFQ
Download sequence
Identical sequences ITC1587_Bchr5_P12102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]