SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr5_P13242 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr5_P13242
Domain Number 1 Region: 255-372
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.38e-19
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 8-53,90-123,182-208
Classification Level Classification E-value
Superfamily POZ domain 3.49e-19
Family BTB/POZ domain 0.022
Further Details:      
 
Weak hits

Sequence:  ITC1587_Bchr5_P13242
Domain Number - Region: 151-191
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0811
Family Skp1 dimerisation domain-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr5_P13242
Sequence length 505
Comment regulatory protein npr5-like
Sequence
MEESLKSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCVLAARSLFFRKFFCGAEPSSP
SGLLLLNPHDRHSPRSPTGGASMSSSSSPRGSACTAGSVIPVNYVSYEVFLLMLQFMYSG
QVPLVPQKHEPRPSCSDRGCWHTHCTAAVDLALDTLAAARSFGIEQLALLTQKQLASMVE
KATIEDVMKVLIASRKQDMNQLWNTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSS
LTGRSFITHHHSLEAAGASTELEDHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALAL
HYAVENCTREVVKALLELGATDVNFRAGPAGKTPLHIAAKMVCPDMVAVLLDHHADPNIR
TFDGVTPLDILRNLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVMSREDAKSGGGG
NHPHSAIYPPMNQQESNTCNANHTSSSMVNLSLDSRMVYLNLGMAERLGCKMSDGADDSS
SSRSLGGGGVGNIGLSSMFSSHGFP
Download sequence
Identical sequences ITC1587_Bchr5_P13242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]