SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr5_P13719 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr5_P13719
Domain Number 1 Region: 114-221
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.28e-29
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr5_P13719
Sequence length 673
Comment auxin response factor 18-like
Sequence
MKGSLMKDSDKCLDSQLWHACAGGMVRMPAMNSRVYYFPQGHAEHAQGVVDFGNLRRIPP
FILCQVTTVKFMADLETDEVFAKIRMAPIRSGVPDYIEDEGLVPEMNEIDVHEKPTSFAK
TLTQSDANNGGGFSVPRYCAETIFPRLDYTADPPVQNVIAKDVHGKVWKFRHIYRGTPRR
HLLTTGWSNFVNQKKLVAGDSIVFLRAENGDLCVGIRRAKRGGVGDSPATQSAWSPQGRN
GASSYGGLSAVLKEEESKLMRGNDSHSVFSRGIRGRGQARADSVVEAATHAANGQPFEVV
YYPRASTPEFCVKATAVKAALRIQWYPGMRFKMAFETEDSSRISWFMGTISSVQVADPIR
WPNSPWRLLQVTWDEPDLLQNVKRVNPWLVELVSNMPAINLGHLPPPIKKQRVLQQPPFE
GQFPVPMVSGTPSVPRDSPYCCFSDSAPAGIQGARHAQFDISLSDLHLNKLQTGLFHAGF
HRLDHATPPSRISTGVIVGNPTIHDKVSCLLTSGHPSQGLNKSCNGKLPQLVLFGQPILT
EQQILLCKSETMIFDDATGTSSSDGNLEKATNVSDGSGFAINHKGPLEAFAHRRDHRALE
LIIEAEHCKVFMESEDVGRSLDLSVFGSYEELYERLGDMFGIEKSEMITHMFYKDAAGAL
KHAGDEPFREMKT
Download sequence
Identical sequences ITC1587_Bchr5_P13719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]