SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr6_P15079 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr6_P15079
Domain Number 1 Region: 529-647
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.51e-20
Family Anti-sigma factor antagonist SpoIIaa 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr6_P15079
Sequence length 864
Comment sulfate transporter
Sequence
MAHSVSDEVESKDIEMANRSSSHRQTENHKSVHKVGLPPRRNFIGEFSEMLKETFFADDP
LRPYKDQPRSRQLVLGLRFLFPIFEWGRSYNLSKFKGDVIAGLTIASLCIPQDIGYAKLA
NMDAKNGLYSSFVPPLIYAVMGSSRDIAIGPVAVVSLLLGTLLQNEVDPENNKEDYLRLA
FTATFFAGVTQAALGFLRLGFLIEFLSHAAIVGFMGGAAITIALQQLKGFLGIKKFTKNT
DIISVMKSVWGSVHHGWNWQTILIGTMFLAFLLSAKYIGKKNRKFFWVPAIAPLISVILS
TFFVYITRADKHGVQIVKKIDRGLNPSSVSQIHFSGPYAAKGFRIGVVAGMIALTEAIAI
GRTFASMKEYQLDGNKEMVAIGTMNIVGSMSSCYVATGSFSRSAVNFMAGCQTSVSNIVM
SMVVMLTLLVITPLFKYTPNAILSSIIISAVISLIDYEAAFLIWKVDKLDFIACMGAFFG
VVFVDVEIGLLIAVSISLAKVLLQVTRPRTALLGHLPSTMVYRNIEQYPEATKVPGVLIV
RVDSAIYFTNSSYVKERILRWLREEEEQLRAKNLPQINFLIVEMSPVTDIDTSGIHAFEE
LYRSLQKHEIQLVLANPGSVVIQKLHLAKFTELIGHDKIFLSVGEAVMTFFICKLALCGT
KQKWDCKSQRAMSRSYERLHLKCELTNIKLTKLNSPDFVGNLFIRCYVNAGGGRRIMIDS
CDVPPTGDPTWDRMASVECSGSSRHVRDLLERHGIVFELRGRRSDRRQAAEAATCSELLG
TAEVPWRDICGPTDTSVHRHVGLVMAGSAHVGDTPPEAVVYMAVRVSKVGKVSKTMEWED
GCEWSVGEEDVFAAAAAAVVDDAF
Download sequence
Identical sequences ITC1587_Bchr6_P15079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]