SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr6_P15914 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr6_P15914
Domain Number 1 Region: 1071-1211
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.03e-42
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 316-384
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000151
Family Splicing factor U2AF subunits 0.043
Further Details:      
 
Domain Number 3 Region: 1583-1657
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000222
Family PB1 domain 0.048
Further Details:      
 
Weak hits

Sequence:  ITC1587_Bchr6_P15914
Domain Number - Region: 384-415
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0549
Family CCCH zinc finger 0.0039
Further Details:      
 
Domain Number - Region: 1991-2037
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 0.0876
Family Band 7/SPFH domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr6_P15914
Sequence length 2104
Comment auxin response factor 1-like
Sequence
MADPSSGAVSPEPVEEAGATADVGCASRKEKRKALKKLKRKQTRKEAAIREREEDEARSN
DPEEQRKIRLREQEEVEIAERERKLFEERERLWFEAAAARKAAEEEEEQRRKELMEKSQE
KNQHDAHVNEVDEDDEWDYIEEGPAEIIWQGNEIIVKKKRVRVAKKNANKQQSEEDDNRP
TSNPLPPQSVAFASYMSGPSISAQEVLERVAQEVPNFGTEQDKAHCPFHLKTGACRFGPR
CSRVHFHPDKSCTLLIKNMYNGPGLVSEQDEGLEESFGRLAPTLIRWSSFCTFMLCRGDN
ISCNYNYTDEEVERCYEEFYEDVHTEFLKFGELVNFKVCKNGSYHLRGNVYVHYKSLDSA
VLAYSNINGRFFAGKQITCEFVGVTKWKVAICGEYMKSKLKTCSHGSACNFIHCFRNPGG
DYEWADWDNPPPKYWIRKMIALFGPSNEYEHHKQVDLKEFDRPRCSDRKRTPIDKRRYCS
RRSDSELDELDNDSPAKNRREQSSRSKEKPTSVEKRERSEEYDKLNYYDDREYKRKHRED
SLGQKRVKPYVNGHMKSKRYKSRFQEQQKYAQFSEYTDDDRELSDGHSNSLSSDKSSHRL
SIDEERYNGRSCSDDLGSDVDPSRRITSQHSGCFTESREYGRRSKHKSYDYEIDGHSGKF
GKPNDHHLRVSSHDLDWKARSEGSDLEDADARLPHSRSRREKKHDRSSRKRNLHQKKGED
NDRSDEPSNKKLKRKEDKRYSSRHCVHTKHYRPLNDLSQPASAGIIRNGLARHGWSFYSV
MPREERSMDEFQLEVGLLLRKEDNLPQIGYLRNLSTSRKWSYDEPTRTADTWRSVSGGSP
AAGPHPTSRLVAAASPGPNHERPQPCLGPYTRCFIPHGINASPSIDYPTRHGFPTPYRVD
VKRFQPSDVSASTDRVNLEGPEEEEIRSTSVCHIPCGHGIHKTIISSKLLVLQTCFLIYG
KILLGRLSIEGTSGDVLYKELWHACAGPLVTLPRENERVYYFPQGHMEQLEASTNQGLDQ
HVPVFNLPPKILCRVVNVELRAEPDTDEVYAHIILLPEPNQGEVTSPDPPLSEPERCKGY
SFCKTLTASDTSTHGGFSVLRRHADECLPPLDMTQDPPCQELVAKDLHRNEWRFRHIFRG
QPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRLMRQLNNMPSSVISSHSM
HLGVLATASHAITTGTLFSVFYKPRASRSEFIISLNKYLEAKKHKFSVGMRFKMRFEGDD
TPERRFSGTIVGAIDKVSSQWADSEWRSLKVQWDEPSSTLCPDSVSPWELEPLIAAAPPS
AQPVQRIKRARLPASPVGTPGPSPTPGMDLAIYNCFQFPSLPVNQNIPRMNFHLYALRSD
QSSYKYSDAIIFPSCRHTAVVVHVGSWKSQVETTQMFSFSGPQRGEEPYSSYKPACIFSS
ASQSGSIGFNASNAPSTAINSHAPSTAINSRLCWPIMTETQSDTFSASINREPCDRKQET
SKGCRLFGIQLIESSGMGEMSPVPTISGVGVDQPAISLEVDSDLQSRPSNIERSDAPADN
SEPEKLCLRSSRETQSRQLRSCTKVHMQGMAVGRAVDLTRLCGYDDLLHKLENMFSIEGE
LSGAVKKWVVVYTDNEDDMMLVGDDPWLEFCSMARKIYIYTSEEAKRLSPKRKLPPVIGE
VVKSGSKKALFDAVANTNAAAGQKGLGGQDDVPGMQLSMLFLVAVWPLVCGTNMGSLIAK
VAVAPVAIVVSGVGDEDKDGFHIVMVCEVHEGKEMMTTNKTFSQLGRTFDCLIVVVVLIL
SSRHTSKAFAYYQPHGKHGQTQQRVDRGNNLHLAPPQPSRPLLRHQPAAQAPAQRNHTAR
RPLQHVHLQRPARNAADILRTLLLVRVPRQLLRLHGRVPGLVACSDSDNPAELVSHLVVL
GHLPEGVLEALQEQQDLRVAGVPVVVDGEECVPVLHQEAEGHVVDGVGVPSVMVKIGLRV
LTWPFANCLPTIYLSLTENYNETVLPSIIHETLKSVVAQYNASQLITQREVAAQEAEQAK
FIVEKAEQDKKCAIIRAQDARLIGQAIAMNPAFLALRRIEAATEVAQKIANSANRAMQSL
MSCC
Download sequence
Identical sequences ITC1587_Bchr6_P15914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]