SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr6_P16455 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr6_P16455
Domain Number 1 Region: 442-610,640-742
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.06e-68
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 41-182
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000586
Family Universal stress protein-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr6_P16455
Sequence length 859
Comment atp binding
Sequence
MAKEGEAAQKKRRRRRWSSKKDEAFVEEEPKEKTGDGGEGKTVVVGIRMDSQSRELLTWA
LVKATAPGDRVLALHVLSSSSSAGGPPPAVDPGGQPAAVFSLAKELDAMLAVYEGFCNLK
QIDLKLKICKGSSIRKLLVSETKSFAASQLILGVTKNDRTMGSYSISVAKYCAKKLPSYC
SVVALSDGKIVFQRAAAGWFVASDLFVLLYVLCFTCNLWSSILLTENNKSQEKSSKDSTK
IDENNEMYCLLPIAGPKRFHDTACRPSLVPEDESTGCSNSPVGNDPNTIDGALRDNCSIC
VPESDPASLNASKDEDSLASAPAGKTGAPLSSSVPIVGKDLPEARHGWPSLRRLALTNRK
SVSSEKHKISVVQWVKWLPNRHQSMHPDHKSKKSDGKHMTLSQDGESCAIVPVGASLPPP
PFLVNDAEERLPEELEPLQQKYSSVCRLFSYDELIQATSSFLPENLIGNGGSSTVYKGYL
SDGKELAVKILKPSEVAVKEFVSEIEIITALHHKNIIPLLGFCMENNSLMLVYEYVSQGN
LEEILHDKEENKHVLSWPERYKVAIGVAEALDYLHGGGGIEPVIHRDVKSSNILLSENFE
PQLSDFGLAKWASATTSQPVCSDVAGTFGSVLFVYQYYIDLSLDQCSNLCTFDDSYLAPE
YILYGKVNEKIDIYAFGVVLLELLSGRKPISSGCPKGQESLVMWAKPILQDGDVKQLIDP
ALKNDFNSDQVERMILAASLCVLKLLQGDDDTVKWARSEVTTRADVLDDEMTNLESDIRS
HLNLALLDVEDDSISVSSTDHTVDSLTRKQSAIIVLQEKEAGLIGRWGRQRVSRITCIKQ
IADERFDAQQLSASQTAQR
Download sequence
Identical sequences ITC1587_Bchr6_P16455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]