SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr7_P19408 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr7_P19408
Domain Number 1 Region: 255-368
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.95e-16
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 55-184
Classification Level Classification E-value
Superfamily POZ domain 0.00000000141
Family BTB/POZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr7_P19408
Sequence length 1160
Comment ankyrin-repeat protein
Sequence
MEDSYLTAAPAFSVSDDSRSVHFAGGASPDPAADVEALRRLSDNLGAAFESPDFESFADA
RITVEDGGARAREVGVHRCVLSARSPFFREVFAEREGALAPVRLELWKLVRGFVVGYDAL
VTVLGYLYRGRVAPLTKEVCMCVDEECRHEACRPVVDFMVEVLYASFVFQISELVSLFQR
HLLDILDKVSIDDIPVILSVANLCDSSCAKLFNKCIEIAVKSNLDIITLEKTMTPDIVKQ
IMDSRLNLGTVGPESINFSDKHVKRIHGALDNDDVDLVRMLLKEGNTTLDDACALHYAVA
YCDSKVTTELLDLELADINHRNIRGYTVLHIAAMRKEPKIIVSLLTKGARPSDLTLDGRK
AVQISKRHTKSKEYFKSTEEGQASPKSRLCIEILEQAERRDPQVGEASAFLAIAGDDLRG
RLLYLENRGRSLFSNLFFKKFRCLGSDAQFKDHNYNEKVNGLQYRTIPLGMGGTSVYLSV
SCVSMLGTARLLFPMEARVAMDIARVDGTLEFTLGSTTSHSTGNQRTAADLNERPFTIKE
EHLARMRALSRTVELGKRFFPRCSAVINKIMDDDSTDFAYLEHDTSEEKRMRFLELQDAL
SRAFSEDKEEFNKSALSSSSSSTSETTHLNQRAEVTLMGLHLSLLNCSWVELMRSKIFAL
TETEDVKTITRSASCKQNELQANTELSALRESLSFKYWDHEQTRPETNVSSKDQYLEDGK
KQPNSAQHTKHDADLKLNPAICPLLSPSPTKDLNAAAVKLQKVYKSYRTRRNLADCAVVA
EELWWKALDFASLKHSSVSFFSGRKPETAASRWARALTRAAKVGKGLSKNNKAQKLALRH
WLEAIDPRHRYGHNLHMYYDIWTKSESKQPFFYWLDIGDGKEVNIAKCPRNKLQQECVKY
LGPKERLTYEVIVEDGKLVYKKNRTLVDTTEGSKWIFVLSTIRALYVGQKKKGSFQHSSF
LAGGATMAAGRLIVKEGTLKAVWPHSGHYLPTEENFQEFISFLEENNVDLTDIKETDVLL
FMVLQRNPVGYDDDYPSFKMTMSDSMTDTDKGVEVEGESTTHHAGDLSDSEAEERPAYSL
GAECHEGNEIETTVESVNHHLRKWTTGVGPRIRCVRNYPTDLQFKALEQVNLSPRLQHGK
MQLSSSHFWPLGVQILKVGA
Download sequence
Identical sequences ITC1587_Bchr7_P19408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]