SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr7_P21184 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr7_P21184
Domain Number 1 Region: 535-609
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000961
Family PB1 domain 0.031
Further Details:      
 
Domain Number 2 Region: 167-200
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000353
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr7_P21184
Sequence length 632
Comment auxin response factor 9-like
Sequence
MATSGNVTGRLARGEDFRYIAVYYRKPQSRLGTTGGPTSRNDKRHVRLDVPRVFNVRVRE
RERDSDTLYEELWRACAGPLVEIPRVDERVYYFPQGHLEQLEVSTDQELNQQIPLFNLPP
KILCRVVNVTLKAEPDTDEVYAQITLIPESDRYQFDSLLFEFFVANQGQPRRHLLTTGWS
TFVASKRLVAGDAFILLRCNQFIVSLNKYLEATKNEFAVGMRFKMKFEGEDVPEKSFTGT
VIGIGDISSQWPGSKWRSLKVTHELLFIHPNCMNIVSEVYYFQVHWDEASSIQKPEKISP
WDVEPFSQPISASGDPQAAFSKKRARSPLDLPGTGKPSSTFRHPVKDQMFDLGPPNNISA
RSSETRFLWSPTQTESINFNYLNIPRPCNRGLLDGWSKDSSSMPHVTPKRLEDAVGDAEA
TLPSWGLASTRITEEPSFDLECKIENEKKPKSSGCYRLFGIDLVSPSTGICSTALSGDHA
CISSATTEDPVAAIALTEDLDEQSGVSKASKETKQVLQASPKEIQSKQNIAARSCTKVHM
QGIAVGRAVDLANLEGYDELFLELEQMFEIKGELRCRDKWEVVFTDDEGDMMLVGDYPWP
EFCEVARKILIYPSEDVKRVEPENKLPATSST
Download sequence
Identical sequences ITC1587_Bchr7_P21184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]